PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G191800.1.p
Common NameSb04g024000, SORBIDRAFT_04g024000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 343aa    MW: 36807.3 Da    PI: 8.4854
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G191800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-181562148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++l+  ++q+G g+W++ +++ g++R++k+c++rw +yl
  Sobic.004G191800.1.p 15 KGPWTPEEDQKLLAFIEQHGHGCWRSLPAKAGLRRCGKSCRLRWTNYL 62
                          79********************************************97 PP

2Myb_DNA-binding54.82.2e-1768113148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Sobic.004G191800.1.p  68 RGKFTLQEEQTIIQLHALLGNR-WSSIATHLP-KRTDNEIKNYWNTHL 113
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-24765IPR009057Homeodomain-like
PROSITE profilePS5129418.321062IPR017930Myb domain
SuperFamilySSF466895.99E-3012109IPR009057Homeodomain-like
SMARTSM007172.5E-151464IPR001005SANT/Myb domain
PfamPF002492.1E-161562IPR001005SANT/Myb domain
CDDcd001674.52E-121762No hitNo description
PROSITE profilePS5129426.82263117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2666117IPR009057Homeodomain-like
SMARTSM007177.1E-1767115IPR001005SANT/Myb domain
PfamPF002491.7E-1668113IPR001005SANT/Myb domain
CDDcd001674.66E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRSPCCEKE AGLKKGPWTP EEDQKLLAFI EQHGHGCWRS LPAKAGLRRC GKSCRLRWTN  60
YLRPDIKRGK FTLQEEQTII QLHALLGNRW SSIATHLPKR TDNEIKNYWN THLKKRLAKM  120
GIDPVTHKPR ADLGASSGSA AGAGAGARYR AAAHLSHTAQ WESARLEAEA RLAREAKLRA  180
IVSPPPAPAP GPGTGPAFIS GLESPTSTLS FSESAQLFAN APPHDTHGTP RHALTPPRSY  240
EEAFGELQPQ QQRFGDAAAP GFVLAGVLLD SSVAGADQQR FAASSTDASV SVSEQQEEED  300
KGYWSSILNM VNSSMSSSSS SLTSDAVTDP AMYLPAAAAA EF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9690260.0EU969026.1 Zea mays clone 325641 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452341.10.0hypothetical protein SORBIDRAFT_04g024000
SwissprotQ8GWP09e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLC5XVR40.0C5XVR4_SORBI; Putative uncharacterized protein Sb04g024000
STRINGSb04g024000.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-86myb domain protein 16